SCOP 1.75: Domain d2nmla1: 2nml A:2-101

Lineage for d2nmla1 (2nml A:2-101)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.330: ERH-like [143874] (1 superfamily)
   beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10

4. Superfamily d.330.1: ERH-like [143875] (1 family)

5. Family d.330.1.1: ERH-like [143876] (1 protein)
   Pfam PF01133

6. Protein Enhancer of rudimentary homolog, ERH [143877] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143878] (4 PDB entries)
   Uniprot P84089 1-104! Uniprot P84090 2-101
   also includes 100% identical human protein P84090 (1W9G)

8. Domain d2nmla1: 2nml A:2-101 [138371]
   human protein, identical to mouse sequence

Details for d2nmla1

PDB Entry: 2nml, 1.55 Å

PDB Description: crystal structure of hef2/erh at 1.55 a resolution

PDB Compounds: (A:) Enhancer of rudimentary homolog

SCOP Domain Sequences for d2nmla1:

Sequence; same for both SEQRES and ATOM records:

>d2nmla1 d.330.1.1 (A:2-101) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
shtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdfi
ddladlsclvyradtqtyqpynkdwikekiyvllrrqaqq

Timeline for d2nmla1:

• d2nmla1 first appeared in SCOP 1.73
  
• d2nmla1 appears in SCOPe 2.01
  
• d2nmla1 appears in the current release, SCOPe 2.08