Lineage for d2nmla1 (2nml A:2-101)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882651Fold d.330: ERH-like [143874] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10
  4. 882652Superfamily d.330.1: ERH-like [143875] (1 family) (S)
  5. 882653Family d.330.1.1: ERH-like [143876] (1 protein)
    Pfam PF01133
  6. 882654Protein Enhancer of rudimentary homolog, ERH [143877] (1 species)
  7. 882655Species Mouse (Mus musculus) [TaxId:10090] [143878] (4 PDB entries)
    Uniprot P84089 1-104! Uniprot P84090 2-101
    also includes 100% identical human protein P84090 (1W9G)
  8. 882656Domain d2nmla1: 2nml A:2-101 [138371]
    human protein, identical to mouse sequence

Details for d2nmla1

PDB Entry: 2nml (more details), 1.55 Å

PDB Description: crystal structure of hef2/erh at 1.55 a resolution
PDB Compounds: (A:) Enhancer of rudimentary homolog

SCOP Domain Sequences for d2nmla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nmla1 d.330.1.1 (A:2-101) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
shtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdfi
ddladlsclvyradtqtyqpynkdwikekiyvllrrqaqq

SCOP Domain Coordinates for d2nmla1:

Click to download the PDB-style file with coordinates for d2nmla1.
(The format of our PDB-style files is described here.)

Timeline for d2nmla1: