Lineage for d2nm1a2 (2nm1 A:1067-1291)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053907Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 protein domains)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2053908Protein Botulinum neurotoxin [50402] (2 species)
  7. 2053909Species Clostridium botulinum, serotype A [TaxId:1491] [50403] (6 PDB entries)
  8. 2053910Domain d2nm1a2: 2nm1 A:1067-1291 [138370]
    Other proteins in same PDB: d2nm1a1, d2nm1a3
    automated match to d4kbba2

Details for d2nm1a2

PDB Entry: 2nm1 (more details), 2.15 Å

PDB Description: Structure of BoNT/B in complex with its protein receptor
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d2nm1a2:

Sequence, based on SEQRES records: (download)

>d2nm1a2 b.42.4.2 (A:1067-1291) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
sqsnieerykiqsyseylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrsk
ynqnskyinyrdlyigekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyf
kkeeeklflapisdsdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyes
givfeeykdyfciskwylkevkrkpynlklgcnwqfipkdegwte

Sequence, based on observed residues (ATOM records): (download)

>d2nm1a2 b.42.4.2 (A:1067-1291) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
sqsnieerykiqsyseylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrsk
ynqnskyinyrdlyigekfiirrksddivrkedyiyldffnlnqewrvytykyfkkeeek
lflapisdsdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfee
ykdyfciskwylkevkrkpynlklgcnwqfipkdegwte

SCOPe Domain Coordinates for d2nm1a2:

Click to download the PDB-style file with coordinates for d2nm1a2.
(The format of our PDB-style files is described here.)

Timeline for d2nm1a2: