Lineage for d2nlzd2 (2nlz D:4-541)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602093Family d.153.1.6: Gamma-glutamyltranspeptidase-like [143906] (4 proteins)
    Pfam PF01019
  6. 2602121Protein automated matches [190739] (1 species)
    not a true protein
  7. 2602122Species Bacillus halodurans [TaxId:86665] [187918] (1 PDB entry)
  8. 2602125Domain d2nlzd2: 2nlz D:4-541 [138368]
    Other proteins in same PDB: d2nlza1, d2nlza2, d2nlzb3, d2nlzc3, d2nlzd3
    automated match to d2nlza1

Details for d2nlzd2

PDB Entry: 2nlz (more details), 2.7 Å

PDB Description: crystal structure of cephalosporin acylase from bacillus halodurans
PDB Compounds: (D:) cephalosporin acylase

SCOPe Domain Sequences for d2nlzd2:

Sequence, based on SEQRES records: (download)

>d2nlzd2 d.153.1.6 (D:4-541) automated matches {Bacillus halodurans [TaxId: 86665]}
mfdpqsypypsrrnvvyakngmvatsqplaaqagldilkaggnaidaaiatataltvlep
tsngigsdafalvwtkgklhglngsgrapmsltmeavkakgyeqelppygvipvtvpgap
gawaelakmygnlplaaslapairyaeegypvtptlakywkaaydrvktewtddvyqpwf
dtfapkgraprvgevwrsqghadtlrsiaesngesfyrgeladqihaffdkhggyltked
lacyrpewvepisidyrgyrvweippngqglvalealnivkgfefyhkdtvdtyhkqiea
mklafvdgmkyvtepsdmsvsveqllsdeyaterrkeigeqaltpepgtpprggtvylat
adgdgnmvsfiqsnymgfgsgvvvpgtgiamqnrghnfsldpnhdnalkpgkrtyhtiip
gfltkndqpigpfgvmggfmqpqghmqvmmntidfglnpqaaldaprwqwtngkqvqvep
tfpvdiaqalvrrghkiqvvldegafgrgqiiwrdpttgvlaggteprtdgqvaaweg

Sequence, based on observed residues (ATOM records): (download)

>d2nlzd2 d.153.1.6 (D:4-541) automated matches {Bacillus halodurans [TaxId: 86665]}
mfdpqsypypsrrnvvyakngmvatsqplaaqagldilkaggnaidaaiatataltvlep
tsngigsdafalvwtkgklhglngsgrapmsltmeavkakgyeqelppygvipvtvpgap
gawaelakmygnlplaaslapairyaeegypvtptlakywkaaydrvktewtddvyqpwf
dtfapkgraprvgevwrsqghadtlrsiaesngesfyrgeladqihaffdkhggyltked
lacyrpewvepisidyrgyrvweippngqglvalealnivkgfefyhkdtvdtyhkqiea
mklafvdgmkyvtepsdmsvsveqllsdeyaterrkeigeqaltpepgtptvylatadgd
gnmvsfiqsnymgfgsgvvvpgtgiamqnrghnfsldpnhdnalkpgkrtyhtiipgflt
kndqpigpfgvmggfmqpqghmqvmmntidfglnpqaaldaprwqwtngkqvqveptfpv
diaqalvrrghkiqvvldegafgrgqiiwrdpttgvlaggteprtdgqvaaweg

SCOPe Domain Coordinates for d2nlzd2:

Click to download the PDB-style file with coordinates for d2nlzd2.
(The format of our PDB-style files is described here.)

Timeline for d2nlzd2: