Lineage for d2nlza1 (2nlz A:3-539)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 736473Family d.153.1.6: Gamma-glutamyltranspeptidase-like [143906] (3 proteins)
    Pfam PF01019
  6. 736474Protein Cephalosporin acylase [143909] (1 species)
  7. 736475Species Bacillus halodurans [TaxId:86665] [143910] (1 PDB entry)
  8. 736476Domain d2nlza1: 2nlz A:3-539 [138365]
    mutant

Details for d2nlza1

PDB Entry: 2nlz (more details), 2.7 Å

PDB Description: crystal structure of cephalosporin acylase from bacillus halodurans
PDB Compounds: (A:) cephalosporin acylase

SCOP Domain Sequences for d2nlza1:

Sequence, based on SEQRES records: (download)

>d2nlza1 d.153.1.6 (A:3-539) Cephalosporin acylase {Bacillus halodurans [TaxId: 86665]}
vmfdpqsypypsrrnvvyakngmvatsqplaaqagldilkaggnaidaaiatataltvle
ptsngigsdafalvwtkgklhglngsgrapmsltmeavkakgyeqelppygvipvtvpga
pgawaelakmygnlplaaslapairyaeegypvtptlakywkaaydrvktewtddvyqpw
fdtfapkgraprvgevwrsqghadtlrsiaesngesfyrgeladqihaffdkhggyltke
dlacyrpewvepisidyrgyrvweippngqglvalealnivkgfefyhkdtvdtyhkqie
amklafvdgmkyvtepsdmsvsveqllsdeyaterrkeigeqaltpepgtpprggtvyla
tadgdgnmvsfiqsnymgfgsgvvvpgtgiamqnrghnfsldpnhdnalkpgkrtyhtii
pgfltkndqpigpfgvmggfmqpqghmqvmmntidfglnpqaaldaprwqwtngkqvqve
ptfpvdiaqalvrrghkiqvvldegafgrgqiiwrdpttgvlaggteprtdgqvaaw

Sequence, based on observed residues (ATOM records): (download)

>d2nlza1 d.153.1.6 (A:3-539) Cephalosporin acylase {Bacillus halodurans [TaxId: 86665]}
vmfdpqsypypsrrnvvyakngmvatsqplaaqagldilkaggnaidaaiatataltvle
ptsngigsdafalvwtkgklhglngsgrapmsltmeavkakgyeqelppygvipvtvpga
pgawaelakmygnlplaaslapairyaeegypvtptlakywkaaydrvktewtddvyqpw
fdtfapkgraprvgevwrsqghadtlrsiaesngesfyrgeladqihaffdkhggyltke
dlacyrpewvepisidyrgyrvweippngqglvalealnivkgfefyhkdtvdtyhkqie
amklafvdgmkyvtepsdmsvsveqllsdeyaterrkeigeqaltpepgtptvylatadg
dgnmvsfiqsnymgfgsgvvvpgtgiamqnrghnfsldpnhdnalkpgkrtyhtiipgfl
tkndqpigpfgvmggfmqpqghmqvmmntidfglnpqaaldaprwqwtngkqvqveptfp
vdiaqalvrrghkiqvvldegafgrgqiiwrdpttgvlaggteprtdgqvaaw

SCOP Domain Coordinates for d2nlza1:

Click to download the PDB-style file with coordinates for d2nlza1.
(The format of our PDB-style files is described here.)

Timeline for d2nlza1: