SCOP 1.75: Domain d2nlya1: 2nly A:31-254

Lineage for d2nlya1 (2nly A:31-254)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (8 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.7: Divergent polysaccharide deacetylase [141968] (1 protein)
   Pfam PF04748

6. Protein Hypothetical protein BH1492 [141969] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [141970] (1 PDB entry)
   Uniprot Q9KCS7 31-254

8. Domain d2nlya1: 2nly A:31-254 [138364]
   complexed with zn

Details for d2nlya1

PDB Entry: 2nly, 2.5 Å

PDB Description: crystal structure of protein bh1492 from bacillus halodurans, pfam duf610

PDB Compounds: (A:) Divergent polysaccharide deacetylase hypothetical protein

SCOP Domain Sequences for d2nlya1:

Sequence, based on SEQRES records:

>d2nlya1 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillus halodurans [TaxId: 86665]}
mkraaiiiddfggdvkgvddfltgeipvtvavmpflehstkqaeiaqaaglevivhmple
pkkgkiswlgpsgitsnlsvgevksrvrkafddipyavglnnhmgskivenekimraile
vvkeknafiidsgtsphslipqlaeelevpyatrsifldnthssrkeviknmrklakkak
qgsepigighvgvrgdetyagirsmldefqaesiqlvpvsqllp

Sequence, based on observed residues (ATOM records):

>d2nlya1 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillus halodurans [TaxId: 86665]}
mkraaiiiddfggdvkgvddfltgeipvtvavmpflehstkqaeiaqaaglevivhmple
pkpsgitsnlsvgevksrvrkafddipyavglnnhmgskivenekimrailevvkeknaf
iidsgtsphslipqlaeelevpyatrsifldnthssrkeviknmrklakkakqgsepigi
ghvgvrgdetyagirsmldefqaesiqlvpvsqllp

Timeline for d2nlya1:

• d2nlya1 first appeared in SCOP 1.73
  
• d2nlya1 appears in SCOPe 2.01
  
• d2nlya1 appears in the current release, SCOPe 2.08