Lineage for d2nlya1 (2nly A:31-254)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850722Family c.6.2.7: Divergent polysaccharide deacetylase [141968] (1 protein)
    Pfam PF04748
  6. 2850723Protein Hypothetical protein BH1492 [141969] (1 species)
  7. 2850724Species Bacillus halodurans [TaxId:86665] [141970] (1 PDB entry)
    Uniprot Q9KCS7 31-254
  8. 2850725Domain d2nlya1: 2nly A:31-254 [138364]
    complexed with zn

Details for d2nlya1

PDB Entry: 2nly (more details), 2.5 Å

PDB Description: crystal structure of protein bh1492 from bacillus halodurans, pfam duf610
PDB Compounds: (A:) Divergent polysaccharide deacetylase hypothetical protein

SCOPe Domain Sequences for d2nlya1:

Sequence, based on SEQRES records: (download)

>d2nlya1 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillus halodurans [TaxId: 86665]}
mkraaiiiddfggdvkgvddfltgeipvtvavmpflehstkqaeiaqaaglevivhmple
pkkgkiswlgpsgitsnlsvgevksrvrkafddipyavglnnhmgskivenekimraile
vvkeknafiidsgtsphslipqlaeelevpyatrsifldnthssrkeviknmrklakkak
qgsepigighvgvrgdetyagirsmldefqaesiqlvpvsqllp

Sequence, based on observed residues (ATOM records): (download)

>d2nlya1 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillus halodurans [TaxId: 86665]}
mkraaiiiddfggdvkgvddfltgeipvtvavmpflehstkqaeiaqaaglevivhmple
pkpsgitsnlsvgevksrvrkafddipyavglnnhmgskivenekimrailevvkeknaf
iidsgtsphslipqlaeelevpyatrsifldnthssrkeviknmrklakkakqgsepigi
ghvgvrgdetyagirsmldefqaesiqlvpvsqllp

SCOPe Domain Coordinates for d2nlya1:

Click to download the PDB-style file with coordinates for d2nlya1.
(The format of our PDB-style files is described here.)

Timeline for d2nlya1: