SCOPe 2.08: Domain d2nlvb_: 2nlv B:

Lineage for d2nlvb_ (2nlv B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.326: XisI-like [143846] (1 superfamily)
   alpha-beta(4)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order 1234, meander; the open side of beta-sheet provides dimerization interface

4. Superfamily d.326.1: XisI-like [143847] (2 families)

5. Family d.326.1.1: XisI-like [143848] (3 proteins)
   Pfam PF08869

6. Protein Hypothetical protein Ava3825 [143849] (1 species)

7. Species Anabaena variabilis [TaxId:1172] [143850] (1 PDB entry)
   Uniprot Q3M6F6 1-111

8. Domain d2nlvb_: 2nlv B: [138363]
   Other proteins in same PDB: d2nlva2
   automated match to d2nlva1
   complexed with cl

Details for d2nlvb_

PDB Entry: 2nlv, 1.3 Å

PDB Description: crystal structure of a xisi-like protein (ava_3825) from anabaena variabilis atcc 29413 at 1.30 a resolution

PDB Compounds: (B:) XisI protein-like

SCOPe Domain Sequences for d2nlvb_:

Sequence; same for both SEQRES and ATOM records:

>d2nlvb_ d.326.1.1 (B:) Hypothetical protein Ava3825 {Anabaena variabilis [TaxId: 1172]}
klvkyqelvkklltnyasddvsdqdvevqlildternhyqwmnvgwqglnriyrcvihfd
ikdgkiwlqqnltdrnpaeelvmmgvpredivlglqapykrqytdygva

Timeline for d2nlvb_:

• d2nlvb_ first appeared in SCOP 1.73, called d2nlvb1
  
• d2nlvb_ appears in SCOPe 2.07