Lineage for d2nlva1 (2nlv A:1-111)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741868Fold d.326: XisI-like [143846] (1 superfamily)
    alpha-beta(4)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order 1234, meander; the open side of beta-sheet provides dimerization interface
  4. 741869Superfamily d.326.1: XisI-like [143847] (1 family) (S)
  5. 741870Family d.326.1.1: XisI-like [143848] (3 proteins)
    Pfam PF08869
  6. 741874Protein Hypothetical protein Ava3825 [143849] (1 species)
  7. 741875Species Anabaena variabilis [TaxId:1172] [143850] (1 PDB entry)
  8. 741876Domain d2nlva1: 2nlv A:1-111 [138362]
    complexed with cl

Details for d2nlva1

PDB Entry: 2nlv (more details), 1.3 Å

PDB Description: crystal structure of a xisi-like protein (ava_3825) from anabaena variabilis atcc 29413 at 1.30 a resolution
PDB Compounds: (A:) XisI protein-like

SCOP Domain Sequences for d2nlva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nlva1 d.326.1.1 (A:1-111) Hypothetical protein Ava3825 {Anabaena variabilis [TaxId: 1172]}
mdklvkyqelvkklltnyasddvsdqdvevqlildternhyqwmnvgwqglnriyrcvih
fdikdgkiwlqqnltdrnpaeelvmmgvpredivlglqapykrqytdygva

SCOP Domain Coordinates for d2nlva1:

Click to download the PDB-style file with coordinates for d2nlva1.
(The format of our PDB-style files is described here.)

Timeline for d2nlva1: