Lineage for d2jqaa1 (2jqa A:2-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768591Superfamily b.2.10: DR1885-like metal-binding protein [110087] (1 family) (S)
  5. 2768592Family b.2.10.1: DR1885-like metal-binding protein [110088] (1 protein)
    Pfam PF04314
  6. 2768593Protein Hypothetical protein DR1885 [110089] (1 species)
  7. 2768594Species Deinococcus radiodurans [TaxId:1299] [110090] (2 PDB entries)
    Uniprot Q9RT80 35-178
  8. 2768595Domain d2jqaa1: 2jqa A:2-145 [138361]
    Other proteins in same PDB: d2jqaa2, d2jqaa3
    automatically matched to d1x7la_

Details for d2jqaa1

PDB Entry: 2jqa (more details)

PDB Description: Solution structure of apo-DR1885 from Deinococcus radiodurans
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2jqaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jqaa1 b.2.10.1 (A:2-145) Hypothetical protein DR1885 {Deinococcus radiodurans [TaxId: 1299]}
ghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpikl
vgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkvg
etvnitlkatdgrtlnvaatvkkn

SCOPe Domain Coordinates for d2jqaa1:

Click to download the PDB-style file with coordinates for d2jqaa1.
(The format of our PDB-style files is described here.)

Timeline for d2jqaa1: