![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.10: DR1885-like metal-binding protein [110087] (1 family) ![]() |
![]() | Family b.2.10.1: DR1885-like metal-binding protein [110088] (1 protein) Pfam PF04314 |
![]() | Protein Hypothetical protein DR1885 [110089] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [110090] (2 PDB entries) Uniprot Q9RT80 35-178 |
![]() | Domain d2jqaa1: 2jqa A:2-145 [138361] Other proteins in same PDB: d2jqaa2, d2jqaa3 automatically matched to d1x7la_ |
PDB Entry: 2jqa (more details)
SCOPe Domain Sequences for d2jqaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jqaa1 b.2.10.1 (A:2-145) Hypothetical protein DR1885 {Deinococcus radiodurans [TaxId: 1299]} ghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpikl vgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkvg etvnitlkatdgrtlnvaatvkkn
Timeline for d2jqaa1: