Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.8: YeeU-like [143737] (1 family) beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer automatically mapped to Pfam PF06154 |
Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins) Pfam PF06154 |
Protein Hypothetical protein YfjZ [143739] (1 species) |
Species Escherichia coli [TaxId:562] [143740] (2 PDB entries) Uniprot P52141 1-105 |
Domain d2jn7a1: 2jn7 A:1-105 [138359] |
PDB Entry: 2jn7 (more details)
SCOPe Domain Sequences for d2jn7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jn7a1 d.110.8.1 (A:1-105) Hypothetical protein YfjZ {Escherichia coli [TaxId: 562]} msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavyptqr
Timeline for d2jn7a1: