SCOP 1.73: Domain d2jn7a1: 2jn7 A:1-105

Lineage for d2jn7a1 (2jn7 A:1-105)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.8: YeeU-like [143737] (1 family)
   beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer

5. Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
   Pfam PF06154

6. Protein Hypothetical protein YfjZ [143739] (1 species)

7. Species Escherichia coli [TaxId:562] [143740] (1 PDB entry)

8. Domain d2jn7a1: 2jn7 A:1-105 [138359]

Details for d2jn7a1

PDB Entry: 2jn7

PDB Description: northeast structural genomics consortium target er411

PDB Compounds: (A:) protein yfjZ

SCOP Domain Sequences for d2jn7a1:

Sequence; same for both SEQRES and ATOM records:

>d2jn7a1 d.110.8.1 (A:1-105) Hypothetical protein YfjZ {Escherichia coli [TaxId: 562]}
msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavyptqr

Timeline for d2jn7a1:

• d2jn7a1 is new in SCOP 1.73
  
• d2jn7a1 appears in SCOP 1.75
  
• d2jn7a1 appears in the current release, SCOPe 2.08