Lineage for d2jm6b_ (2jm6 B:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955371Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)
  7. 1955374Species Mouse (Mus musculus) [TaxId:10090] [118213] (5 PDB entries)
    Uniprot P97287 152-308
  8. 1955378Domain d2jm6b_: 2jm6 B: [138356]
    automated match to d2roda1

Details for d2jm6b_

PDB Entry: 2jm6 (more details)

PDB Description: solution structure of mcl-1 complexed with noxab
PDB Compounds: (B:) Myeloid cell leukemia-1 protein Mcl-1 homolog

SCOPe Domain Sequences for d2jm6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jm6b_ f.1.4.1 (B:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

SCOPe Domain Coordinates for d2jm6b_:

Click to download the PDB-style file with coordinates for d2jm6b_.
(The format of our PDB-style files is described here.)

Timeline for d2jm6b_: