SCOP 1.73: Domain d2jm6b1: 2jm6 B:147-308

Lineage for d2jm6b1 (2jm6 B:147-308)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118213] (2 PDB entries)

8. Domain d2jm6b1: 2jm6 B:147-308 [138356]
   automatically matched to d1wsxa_

Details for d2jm6b1

PDB Entry: 2jm6

PDB Description: solution structure of mcl-1 complexed with noxab

PDB Compounds: (B:) Myeloid cell leukemia-1 protein Mcl-1 homolog

SCOP Domain Sequences for d2jm6b1:

Sequence; same for both SEQRES and ATOM records:

>d2jm6b1 f.1.4.1 (B:147-308) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

Timeline for d2jm6b1:

• d2jm6b1 is new in SCOP 1.73
  
• d2jm6b1 appears in SCOP 1.75
  
• d2jm6b1 appears in the current release, SCOPe 2.08, called d2jm6b2