SCOPe 2.08: Domain d2jm6b2: 2jm6 B:152-308

Lineage for d2jm6b2 (2jm6 B:152-308)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118213] (6 PDB entries)
   Uniprot P97287 152-308

8. Domain d2jm6b2: 2jm6 B:152-308 [138356]
   Other proteins in same PDB: d2jm6b3
   automated match to d2roda1

Details for d2jm6b2

PDB Entry: 2jm6

PDB Description: solution structure of mcl-1 complexed with noxab

PDB Compounds: (B:) Myeloid cell leukemia-1 protein Mcl-1 homolog

SCOPe Domain Sequences for d2jm6b2:

Sequence; same for both SEQRES and ATOM records:

>d2jm6b2 f.1.4.1 (B:152-308) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
eddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqg
mlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqesfiepl
aetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

Timeline for d2jm6b2:

• d2jm6b2 first appeared in SCOP 1.73, called d2jm6b1
  
• d2jm6b2 appears in SCOPe 2.07