SCOPe 2.07: Domain d2jm5a1: 2jm5 A:3-134

Lineage for d2jm5a1 (2jm5 A:3-134)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein Regulator of G-protein signaling 18, RGS18 [140750] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140751] (1 PDB entry)
   Uniprot Q9NS28 75-206

8. Domain d2jm5a1: 2jm5 A:3-134 [138355]
   Other proteins in same PDB: d2jm5a2

Details for d2jm5a1

PDB Entry: 2jm5

PDB Description: solution structure of the rgs domain from human rgs18

PDB Compounds: (A:) Regulator of G-protein signaling 18

SCOPe Domain Sequences for d2jm5a1:

Sequence; same for both SEQRES and ATOM records:

>d2jm5a1 a.91.1.1 (A:3-134) Regulator of G-protein signaling 18, RGS18 {Human (Homo sapiens) [TaxId: 9606]}
vspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqihlk
akaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrflk
sdiyldlmegrp

Timeline for d2jm5a1:

• d2jm5a1 first appeared in SCOP 1.73
  
• d2jm5a1 appears in SCOPe 2.06
  
• d2jm5a1 appears in the current release, SCOPe 2.08