Lineage for d2ji3c2 (2ji3 C:1-37)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263360Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 2263361Protein automated matches [232943] (3 species)
    not a true protein
  7. 2263362Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255262] (3 PDB entries)
  8. 2263373Domain d2ji3c2: 2ji3 C:1-37 [138352]
    Other proteins in same PDB: d2ji3a1, d2ji3b1, d2ji3c1, d2ji3d1
    automated match to d1vzga2
    complexed with ca, fe, no3, per; mutant

Details for d2ji3c2

PDB Entry: 2ji3 (more details), 1.95 Å

PDB Description: x-ray structure of the iron-peroxide intermediate of superoxide reductase (e114a mutant) from desulfoarculus baarsii
PDB Compounds: (C:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji3c2 g.41.5.0 (C:1-37) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
mperlqvykcevcgnivevlnggigelvccnqdmklm

SCOPe Domain Coordinates for d2ji3c2:

Click to download the PDB-style file with coordinates for d2ji3c2.
(The format of our PDB-style files is described here.)

Timeline for d2ji3c2: