Lineage for d2ji3c2 (2ji3 C:2-37)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750855Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 750946Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 750947Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)
  7. 750955Species Desulfovibrio desulfuricans [TaxId:876] [57817] (4 PDB entries)
  8. 750967Domain d2ji3c2: 2ji3 C:2-37 [138352]
    Other proteins in same PDB: d2ji3a1, d2ji3b1, d2ji3c1, d2ji3d1
    automatically matched to d1dfx_2
    complexed with ca, fe, no3, per; mutant

Details for d2ji3c2

PDB Entry: 2ji3 (more details), 1.95 Å

PDB Description: x-ray structure of the iron-peroxide intermediate of superoxide reductase (e114a mutant) from desulfoarculus baarsii
PDB Compounds: (C:) desulfoferrodoxin

SCOP Domain Sequences for d2ji3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji3c2 g.41.5.2 (C:2-37) Desulfoferrodoxin N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
perlqvykcevcgnivevlnggigelvccnqdmklm

SCOP Domain Coordinates for d2ji3c2:

Click to download the PDB-style file with coordinates for d2ji3c2.
(The format of our PDB-style files is described here.)

Timeline for d2ji3c2: