![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
![]() | Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
![]() | Protein automated matches [190694] (3 species) not a true protein |
![]() | Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255263] (3 PDB entries) |
![]() | Domain d2ji3c1: 2ji3 C:38-126 [138351] Other proteins in same PDB: d2ji3a2, d2ji3b2, d2ji3c2, d2ji3d2 automated match to d1vzga1 complexed with ca, fe, no3, per; mutant |
PDB Entry: 2ji3 (more details), 1.95 Å
SCOPe Domain Sequences for d2ji3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji3c1 b.1.13.1 (C:38-126) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]} sentvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq apeavflieaakvvaraycnihghwkaen
Timeline for d2ji3c1: