Lineage for d2ji3a1 (2ji3 A:39-126)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658472Superfamily b.1.13: Superoxide reductase-like [49367] (1 family) (S)
  5. 658473Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
  6. 658474Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)
  7. 658482Species Desulfovibrio desulfuricans [TaxId:876] [49372] (4 PDB entries)
  8. 658492Domain d2ji3a1: 2ji3 A:39-126 [138347]
    Other proteins in same PDB: d2ji3a2, d2ji3b2, d2ji3c2, d2ji3d2
    automatically matched to d1dfx_1
    complexed with ca, fe, no3, per; mutant

Details for d2ji3a1

PDB Entry: 2ji3 (more details), 1.95 Å

PDB Description: x-ray structure of the iron-peroxide intermediate of superoxide reductase (e114a mutant) from desulfoarculus baarsii
PDB Compounds: (A:) desulfoferrodoxin

SCOP Domain Sequences for d2ji3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji3a1 b.1.13.1 (A:39-126) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
entvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgqa
peavflieaakvvaraycnihghwkaen

SCOP Domain Coordinates for d2ji3a1:

Click to download the PDB-style file with coordinates for d2ji3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ji3a1: