Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (1 family) |
Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins |
Protein Desulfoferrodoxin C-terminal domain [49371] (2 species) |
Species Desulfovibrio desulfuricans [TaxId:876] [49372] (4 PDB entries) |
Domain d2ji3a1: 2ji3 A:39-126 [138347] Other proteins in same PDB: d2ji3a2, d2ji3b2, d2ji3c2, d2ji3d2 automatically matched to d1dfx_1 complexed with ca, fe, no3, per; mutant |
PDB Entry: 2ji3 (more details), 1.95 Å
SCOP Domain Sequences for d2ji3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji3a1 b.1.13.1 (A:39-126) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} entvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgqa peavflieaakvvaraycnihghwkaen
Timeline for d2ji3a1: