SCOP 1.73: Domain d2ji2d2: 2ji2 D:2-37

Lineage for d2ji2d2 (2ji2 D:2-37)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.2: Desulforedoxin [57813] (2 proteins)

6. Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [57817] (4 PDB entries)

8. Domain d2ji2d2: 2ji2 D:2-37 [138346]
   Other proteins in same PDB: d2ji2a1, d2ji2b1, d2ji2c1, d2ji2d1
   automatically matched to d1dfx_2
   complexed with ca, fe, fe2, no3; mutant

Details for d2ji2d2

PDB Entry: 2ji2, 1.7 Å

PDB Description: x-ray structure of e114a mutant of superoxide reductase from desulfoarculus baarsii in the native, reduced form

PDB Compounds: (D:) desulfoferrodoxin

SCOP Domain Sequences for d2ji2d2:

Sequence; same for both SEQRES and ATOM records:

>d2ji2d2 g.41.5.2 (D:2-37) Desulfoferrodoxin N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
perlqvykcevcgnivevlnggigelvccnqdmklm

Timeline for d2ji2d2:

• d2ji2d2 is new in SCOP 1.73
  
• d2ji2d2 appears in SCOP 1.75
  
• d2ji2d2 appears in the current release, SCOPe 2.08