SCOP 1.73: Domain d2ji2d1: 2ji2 D:39-126

Lineage for d2ji2d1 (2ji2 D:39-126)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (1 family)

5. Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins

6. Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [49372] (4 PDB entries)

8. Domain d2ji2d1: 2ji2 D:39-126 [138345]
   Other proteins in same PDB: d2ji2a2, d2ji2b2, d2ji2c2, d2ji2d2
   automatically matched to d1dfx_1
   complexed with ca, fe, fe2, no3; mutant

Details for d2ji2d1

PDB Entry: 2ji2, 1.7 Å

PDB Description: x-ray structure of e114a mutant of superoxide reductase from desulfoarculus baarsii in the native, reduced form

PDB Compounds: (D:) desulfoferrodoxin

SCOP Domain Sequences for d2ji2d1:

Sequence; same for both SEQRES and ATOM records:

>d2ji2d1 b.1.13.1 (D:39-126) Desulfoferrodoxin C-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
entvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgqa
peavflieaakvvaraycnihghwkaen

Timeline for d2ji2d1:

• d2ji2d1 is new in SCOP 1.73
  
• d2ji2d1 appears in SCOP 1.75
  
• d2ji2d1 appears in the current release, SCOPe 2.08