Lineage for d2ji2d1 (2ji2 D:38-126)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. Protein automated matches [190694] (3 species)
    not a true protein
  7. Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255263] (3 PDB entries)
  8. Domain d2ji2d1: 2ji2 D:38-126 [138345]
    Other proteins in same PDB: d2ji2a2, d2ji2b2, d2ji2c2, d2ji2d2
    automated match to d1vzga1
    complexed with ca, fe, fe2, no3; mutant

Details for d2ji2d1

PDB Entry: 2ji2 (more details), 1.7000000000000002 Å

PDB Description: x-ray structure of e114a mutant of superoxide reductase from desulfoarculus baarsii in the native, reduced form
PDB Compounds: (D:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji2d1 b.1.13.1 (D:38-126) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
sentvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq
apeavflieaakvvaraycnihghwkaen

SCOPe Domain Coordinates for d2ji2d1 are not available.

Timeline for d2ji2d1:

Domains from same chain:
(mouse over for more information)
d2ji2d2
Domains from other chains:
(mouse over for more information)
d2ji2a1, d2ji2a2, d2ji2b1, d2ji2b2, d2ji2c1, d2ji2c2