Lineage for d2ji2c2 (2ji2 C:2-37)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464316Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
    automatically mapped to Pfam PF06397
  6. 1464317Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)
  7. 1464318Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [111452] (6 PDB entries)
    Uniprot Q46495
  8. 1464323Domain d2ji2c2: 2ji2 C:2-37 [138344]
    Other proteins in same PDB: d2ji2a1, d2ji2b1, d2ji2c1, d2ji2d1
    automatically matched to d1dfx_2
    complexed with ca, fe, fe2, no3; mutant

Details for d2ji2c2

PDB Entry: 2ji2 (more details), 1.7 Å

PDB Description: x-ray structure of e114a mutant of superoxide reductase from desulfoarculus baarsii in the native, reduced form
PDB Compounds: (C:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji2c2 g.41.5.2 (C:2-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
perlqvykcevcgnivevlnggigelvccnqdmklm

SCOPe Domain Coordinates for d2ji2c2:

Click to download the PDB-style file with coordinates for d2ji2c2.
(The format of our PDB-style files is described here.)

Timeline for d2ji2c2: