Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.2: Desulforedoxin [57813] (2 proteins) automatically mapped to Pfam PF06397 |
Protein Desulfoferrodoxin N-terminal domain [57816] (2 species) |
Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [111452] (6 PDB entries) Uniprot Q46495 |
Domain d2ji2c2: 2ji2 C:2-37 [138344] Other proteins in same PDB: d2ji2a1, d2ji2b1, d2ji2c1, d2ji2d1 automatically matched to d1dfx_2 complexed with ca, fe, fe2, no3; mutant |
PDB Entry: 2ji2 (more details), 1.7 Å
SCOPe Domain Sequences for d2ji2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji2c2 g.41.5.2 (C:2-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]} perlqvykcevcgnivevlnggigelvccnqdmklm
Timeline for d2ji2c2: