Lineage for d2ji2b2 (2ji2 B:2-37)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587893Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 2587894Protein automated matches [232943] (3 species)
    not a true protein
  7. 2587895Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255262] (3 PDB entries)
  8. 2587897Domain d2ji2b2: 2ji2 B:2-37 [138342]
    Other proteins in same PDB: d2ji2a1, d2ji2b1, d2ji2c1, d2ji2d1
    automated match to d2ji2b2
    complexed with ca, fe, fe2, no3; mutant

Details for d2ji2b2

PDB Entry: 2ji2 (more details), 1.7 Å

PDB Description: x-ray structure of e114a mutant of superoxide reductase from desulfoarculus baarsii in the native, reduced form
PDB Compounds: (B:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji2b2 g.41.5.0 (B:2-37) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
perlqvykcevcgnivevlnggigelvccnqdmklm

SCOPe Domain Coordinates for d2ji2b2:

Click to download the PDB-style file with coordinates for d2ji2b2.
(The format of our PDB-style files is described here.)

Timeline for d2ji2b2: