Lineage for d2ji2a2 (2ji2 A:1-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036792Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 3036793Protein automated matches [232943] (4 species)
    not a true protein
  7. 3036794Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255262] (3 PDB entries)
  8. 3036795Domain d2ji2a2: 2ji2 A:1-37 [138340]
    Other proteins in same PDB: d2ji2a1, d2ji2b1, d2ji2c1, d2ji2d1
    automated match to d2ji2a2
    complexed with ca, fe, fe2, no3; mutant

Details for d2ji2a2

PDB Entry: 2ji2 (more details), 1.7 Å

PDB Description: x-ray structure of e114a mutant of superoxide reductase from desulfoarculus baarsii in the native, reduced form
PDB Compounds: (A:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji2a2 g.41.5.0 (A:1-37) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
mperlqvykcevcgnivevlnggigelvccnqdmklm

SCOPe Domain Coordinates for d2ji2a2:

Click to download the PDB-style file with coordinates for d2ji2a2.
(The format of our PDB-style files is described here.)

Timeline for d2ji2a2: