Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) |
Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
Protein automated matches [190694] (3 species) not a true protein |
Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255263] (3 PDB entries) |
Domain d2ji1d1: 2ji1 D:38-126 [138337] Other proteins in same PDB: d2ji1a2, d2ji1b2, d2ji1c2, d2ji1d2 automated match to d1vzga1 complexed with ca, fe, fe2 |
PDB Entry: 2ji1 (more details), 1.7 Å
SCOPe Domain Sequences for d2ji1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji1d1 b.1.13.1 (D:38-126) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]} sentvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq apeavflieaakvvareycnihghwkaen
Timeline for d2ji1d1: