Lineage for d2ji1c2 (2ji1 C:2-37)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705990Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1706206Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 1706207Protein automated matches [232943] (2 species)
    not a true protein
  7. 1706208Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255262] (3 PDB entries)
  8. 1706215Domain d2ji1c2: 2ji1 C:2-37 [138336]
    Other proteins in same PDB: d2ji1a1, d2ji1b1, d2ji1c1, d2ji1d1
    automated match to d2ji2a2
    complexed with ca, fe, fe2

Details for d2ji1c2

PDB Entry: 2ji1 (more details), 1.7 Å

PDB Description: x-ray structure of wild-type superoxide reductase from desulfoarculus baarsii
PDB Compounds: (C:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji1c2 g.41.5.0 (C:2-37) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
perlqvykcevcgnivevlnggigelvccnqdmklm

SCOPe Domain Coordinates for d2ji1c2:

Click to download the PDB-style file with coordinates for d2ji1c2.
(The format of our PDB-style files is described here.)

Timeline for d2ji1c2: