![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.0: automated matches [232942] (1 protein) not a true family |
![]() | Protein automated matches [232943] (4 species) not a true protein |
![]() | Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255262] (3 PDB entries) |
![]() | Domain d2ji1b2: 2ji1 B:2-37 [138334] Other proteins in same PDB: d2ji1a1, d2ji1b1, d2ji1c1, d2ji1d1 automated match to d2ji2a2 complexed with ca, fe, fe2 |
PDB Entry: 2ji1 (more details), 1.7 Å
SCOPe Domain Sequences for d2ji1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji1b2 g.41.5.0 (B:2-37) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]} perlqvykcevcgnivevlnggigelvccnqdmklm
Timeline for d2ji1b2: