| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
| Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
| Protein automated matches [190694] (3 species) not a true protein |
| Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255263] (3 PDB entries) |
| Domain d2ji1b1: 2ji1 B:38-126 [138333] Other proteins in same PDB: d2ji1a2, d2ji1b2, d2ji1c2, d2ji1d2 automated match to d1vzga1 complexed with ca, fe, fe2 |
PDB Entry: 2ji1 (more details), 1.7 Å
SCOPe Domain Sequences for d2ji1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji1b1 b.1.13.1 (B:38-126) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
sentvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq
apeavflieaakvvareycnihghwkaen
Timeline for d2ji1b1: