| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
| Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries) |
| Domain d2jhvf2: 2jhv F:67-202 [138330] Other proteins in same PDB: d2jhva3, d2jhvb3, d2jhvc3, d2jhvd3, d2jhve3, d2jhvf3 automated match to d1kmta_ mutant |
PDB Entry: 2jhv (more details), 2.07 Å
SCOPe Domain Sequences for d2jhvf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhvf2 b.1.18.8 (F:67-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdw
Timeline for d2jhvf2: