Lineage for d2jhvf2 (2jhv F:67-202)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. Domain d2jhvf2: 2jhv F:67-202 [138330]
    Other proteins in same PDB: d2jhva3, d2jhvb3, d2jhvc3, d2jhvd3, d2jhve3, d2jhvf3
    automated match to d1kmta_
    mutant

Details for d2jhvf2

PDB Entry: 2jhv (more details), 2.07 Å

PDB Description: crystal structure of rhogdi e154a,e155a mutant
PDB Compounds: (F:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhvf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhvf2 b.1.18.8 (F:67-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdw

SCOPe Domain Coordinates for d2jhvf2 are not available.

Timeline for d2jhvf2:

Domains from same chain:
(mouse over for more information)
d2jhvf3
Domains from other chains:
(mouse over for more information)
d2jhva2, d2jhva3, d2jhvb2, d2jhvb3, d2jhvc2, d2jhvc3, d2jhvd2, d2jhvd3, d2jhve2, d2jhve3