Lineage for d2jhvd_ (2jhv D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770659Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 1770677Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 1770682Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 1770695Domain d2jhvd_: 2jhv D: [138328]
    automated match to d1kmta_
    mutant

Details for d2jhvd_

PDB Entry: 2jhv (more details), 2.07 Å

PDB Description: crystal structure of rhogdi e154a,e155a mutant
PDB Compounds: (D:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhvd_ b.1.18.8 (D:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

SCOPe Domain Coordinates for d2jhvd_:

Click to download the PDB-style file with coordinates for d2jhvd_.
(The format of our PDB-style files is described here.)

Timeline for d2jhvd_: