Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries) |
Domain d2jhvb2: 2jhv B:67-202 [138326] Other proteins in same PDB: d2jhva3, d2jhvb3, d2jhvc3, d2jhvd3, d2jhve3, d2jhvf3 automated match to d1kmta_ mutant |
PDB Entry: 2jhv (more details), 2.07 Å
SCOPe Domain Sequences for d2jhvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhvb2 b.1.18.8 (B:67-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]} vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm kyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdddk tdhlswewnltikkdw
Timeline for d2jhvb2: