| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Myoglobin [46469] (9 species) |
| Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries) Uniprot P02185 |
| Domain d2jhoa1: 2jho A:1-153 [138322] automatically matched to d1ufpa_ complexed with cyn, hem, so4, zn |
PDB Entry: 2jho (more details), 1.4 Å
SCOPe Domain Sequences for d2jhoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhoa1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d2jhoa1: