SCOPe 2.05: Domain d2jhoa1: 2jho A:1-153

Lineage for d2jhoa1 (2jho A:1-153)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries)
   Uniprot P02185

8. Domain d2jhoa1: 2jho A:1-153 [138322]
   automatically matched to d1ufpa_
   complexed with cyn, hem, so4, zn

Details for d2jhoa1

PDB Entry: 2jho, 1.4 Å

PDB Description: cyanomet sperm whale myoglobin at 1.4a resolution

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2jhoa1:

Sequence; same for both SEQRES and ATOM records:

>d2jhoa1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2jhoa1:

• d2jhoa1 first appeared in SCOP 1.73
  
• d2jhoa1 appears in SCOPe 2.04
  
• d2jhoa1 appears in SCOPe 2.06
  
• d2jhoa1 appears in the current release, SCOPe 2.08