![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (9 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [51738] (52 PDB entries) Uniprot P00327 |
![]() | Domain d2jhgb2: 2jhg B:164-339 [138321] Other proteins in same PDB: d2jhga1, d2jhgb1 automated match to d1heta2 complexed with ibo, nad, zn |
PDB Entry: 2jhg (more details), 1.2 Å
SCOPe Domain Sequences for d2jhgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhgb2 c.2.1.1 (B:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk
Timeline for d2jhgb2: