Lineage for d2jhgb1 (2jhg B:1-163,B:340-374)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 947658Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 947659Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 947780Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 947798Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 947815Species Horse (Equus caballus) [TaxId:9796] [50138] (36 PDB entries)
    Uniprot P00327
  8. 947825Domain d2jhgb1: 2jhg B:1-163,B:340-374 [138320]
    Other proteins in same PDB: d2jhga2, d2jhgb2
    automatically matched to d1a71a1
    complexed with ibo, nad, zn

Details for d2jhgb1

PDB Entry: 2jhg (more details), 1.2 Å

PDB Description: structural evidence for a ligand coordination switch in liver alcohol dehydrogenase
PDB Compounds: (B:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d2jhgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhgb1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d2jhgb1:

Click to download the PDB-style file with coordinates for d2jhgb1.
(The format of our PDB-style files is described here.)

Timeline for d2jhgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jhgb2