SCOPe 2.08: Domain d2jhga1: 2jhg A:1-163,A:340-374

Lineage for d2jhga1 (2jhg A:1-163,A:340-374)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries)
   Uniprot P00327

8. Domain d2jhga1: 2jhg A:1-163,A:340-374 [138318]
   Other proteins in same PDB: d2jhga2, d2jhgb2
   automated match to d1heta1
   complexed with ibo, nad, zn

Details for d2jhga1

PDB Entry: 2jhg, 1.2 Å

PDB Description: structural evidence for a ligand coordination switch in liver alcohol dehydrogenase

PDB Compounds: (A:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d2jhga1:

Sequence; same for both SEQRES and ATOM records:

>d2jhga1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

Timeline for d2jhga1:

• d2jhga1 first appeared in SCOP 1.73
  
• d2jhga1 appears in SCOPe 2.07