Lineage for d2jhfa1 (2jhf A:1-163,A:340-374)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2055849Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2055850Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2055978Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2055999Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2056016Species Horse (Equus caballus) [TaxId:9796] [50138] (46 PDB entries)
    Uniprot P00327
  8. 2056017Domain d2jhfa1: 2jhf A:1-163,A:340-374 [138314]
    Other proteins in same PDB: d2jhfa2, d2jhfb2
    automated match to d1heta1
    complexed with cd, dms, nad

Details for d2jhfa1

PDB Entry: 2jhf (more details), 1 Å

PDB Description: structural evidence for a ligand coordination switch in liver alcohol dehydrogenase
PDB Compounds: (A:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d2jhfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d2jhfa1:

Click to download the PDB-style file with coordinates for d2jhfa1.
(The format of our PDB-style files is described here.)

Timeline for d2jhfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jhfa2