Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) |
Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
Protein automated matches [254548] (5 species) not a true protein |
Species Escherichia coli [TaxId:562] [255257] (8 PDB entries) |
Domain d2jfha1: 2jfh A:1-93 [138309] Other proteins in same PDB: d2jfha2, d2jfha3, d2jfha4 automated match to d2jfga1 complexed with lk1, so4 |
PDB Entry: 2jfh (more details), 1.97 Å
SCOPe Domain Sequences for d2jfha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfha1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]} adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde wlmaadlivaspgialahpslsaaadagieivg
Timeline for d2jfha1: