Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) |
Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins) |
Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species) |
Species Escherichia coli [TaxId:562] [53247] (9 PDB entries) |
Domain d2jffa2: 2jff A:298-437 [138304] Other proteins in same PDB: d2jffa1, d2jffa3 automatically matched to d1e0da2 complexed with lk2, so4 |
PDB Entry: 2jff (more details), 1.89 Å
SCOP Domain Sequences for d2jffa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jffa2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld qfknfeqrgnefarlakelg
Timeline for d2jffa2: