SCOPe 2.06: Domain d2jfcf2: 2jfc F:160-336

Lineage for d2jfcf2 (2jfc F:160-336)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein automated matches [226877] (4 species)
   not a true protein

7. Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries)

8. Domain d2jfcf2: 2jfc F:160-336 [138302]
   automated match to d1oe1a2
   complexed with cl, cu; mutant

Details for d2jfcf2

PDB Entry: 2jfc, 2.4 Å

PDB Description: m144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121

PDB Compounds: (F:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2jfcf2:

Sequence; same for both SEQRES and ATOM records:

>d2jfcf2 b.6.1.3 (F:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

Timeline for d2jfcf2:

• d2jfcf2 first appeared in SCOP 1.73
  
• d2jfcf2 appears in SCOPe 2.05
  
• d2jfcf2 appears in SCOPe 2.07
  
• d2jfcf2 appears in the current release, SCOPe 2.08