Lineage for d2jfce2 (2jfc E:160-336)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein automated matches [226877] (4 species)
    not a true protein
  7. Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries)
  8. Domain d2jfce2: 2jfc E:160-336 [138300]
    automated match to d1oe1a2
    complexed with cl, cu; mutant

Details for d2jfce2

PDB Entry: 2jfc (more details), 2.4 Å

PDB Description: m144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121
PDB Compounds: (E:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2jfce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfce2 b.6.1.3 (E:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

SCOPe Domain Coordinates for d2jfce2 are not available.

Timeline for d2jfce2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jfce1
View in 3D
Domains from other chains:
(mouse over for more information)
d2jfca1, d2jfca2, d2jfcb1, d2jfcb2, d2jfcc1, d2jfcc2, d2jfcd1, d2jfcd2, d2jfcf1, d2jfcf2