![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein automated matches [226877] (4 species) not a true protein |
![]() | Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries) |
![]() | Domain d2jfce2: 2jfc E:160-336 [138300] automated match to d1oe1a2 complexed with cl, cu; mutant |
PDB Entry: 2jfc (more details), 2.4 Å
SCOPe Domain Sequences for d2jfce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfce2 b.6.1.3 (E:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]} qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
Timeline for d2jfce2: