SCOPe 2.05: Domain d2jfcc1: 2jfc C:2-159

Lineage for d2jfcc1 (2jfc C:2-159)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein automated matches [226877] (3 species)
   not a true protein

7. Species Achromobacter xylosoxidans [TaxId:85698] [225099] (10 PDB entries)

8. Domain d2jfcc1: 2jfc C:2-159 [138295]
   automated match to d1gs7a1
   complexed with cl, cu; mutant

Details for d2jfcc1

PDB Entry: 2jfc, 2.4 Å

PDB Description: m144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121

PDB Compounds: (C:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2jfcc1:

Sequence; same for both SEQRES and ATOM records:

>d2jfcc1 b.6.1.3 (C:2-159) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdp

Timeline for d2jfcc1:

• d2jfcc1 first appeared in SCOP 1.73
  
• d2jfcc1 appears in SCOPe 2.04
  
• d2jfcc1 appears in SCOPe 2.06
  
• d2jfcc1 appears in the current release, SCOPe 2.08