Lineage for d2jfca1 (2jfc A:2-159)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791669Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 791890Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
    Uniprot O68601 25-360
    Uniprot O68601 26-359
    Uniprot O68601
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 791967Domain d2jfca1: 2jfc A:2-159 [138291]
    automatically matched to d1gs6x1
    complexed with cl, cu; mutant

Details for d2jfca1

PDB Entry: 2jfc (more details), 2.4 Å

PDB Description: m144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOP Domain Sequences for d2jfca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfca1 b.6.1.3 (A:2-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdp

SCOP Domain Coordinates for d2jfca1:

Click to download the PDB-style file with coordinates for d2jfca1.
(The format of our PDB-style files is described here.)

Timeline for d2jfca1: