SCOPe 2.06: Domain d2jf3a_: 2jf3 A:

Lineage for d2jf3a_ (2jf3 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
   this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain

6. Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)

7. Species Escherichia coli, gene lpxA [TaxId:562] [51164] (6 PDB entries)

8. Domain d2jf3a_: 2jf3 A: [138290]
   automated match to d2jf2a_
   complexed with ud1

Details for d2jf3a_

PDB Entry: 2jf3, 3 Å

PDB Description: Nucleotide substrate binding by UDP-N-acetylglucosamine acyltransferase

PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d2jf3a_:

Sequence; same for both SEQRES and ATOM records:

>d2jf3a_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

Timeline for d2jf3a_:

• d2jf3a_ first appeared in SCOP 1.73, called d2jf3a1
  
• d2jf3a_ appears in SCOPe 2.05
  
• d2jf3a_ appears in SCOPe 2.07
  
• d2jf3a_ appears in the current release, SCOPe 2.08