SCOP 1.73: Domain d2jf2a1: 2jf2 A:1-262

Lineage for d2jf2a1 (2jf2 A:1-262)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (7 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
   this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain

6. Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)

7. Species Escherichia coli, gene lpxA [TaxId:562] [51164] (4 PDB entries)

8. Domain d2jf2a1: 2jf2 A:1-262 [138289]
   automatically matched to d1lxa__
   complexed with edo, peg

Details for d2jf2a1

PDB Entry: 2jf2, 1.8 Å

PDB Description: Nucleotide substrate binding by UDP-N-acetylglucosamine acyltransferase

PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOP Domain Sequences for d2jf2a1:

Sequence; same for both SEQRES and ATOM records:

>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

Timeline for d2jf2a1:

• d2jf2a1 is new in SCOP 1.73
  
• d2jf2a1 appears in SCOP 1.75
  
• d2jf2a1 appears in the current release, SCOPe 2.08, called d2jf2a_