Lineage for d2jeva_ (2jev A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209547Protein automated matches [190241] (12 species)
    not a true protein
  7. 2209566Species Human (Homo sapiens) [TaxId:9606] [187321] (10 PDB entries)
  8. 2209574Domain d2jeva_: 2jev A: [138287]
    automated match to d2b3ua1
    complexed with nhq

Details for d2jeva_

PDB Entry: 2jev (more details), 2.3 Å

PDB Description: crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
PDB Compounds: (A:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2jeva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeva_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate

SCOPe Domain Coordinates for d2jeva_:

Click to download the PDB-style file with coordinates for d2jeva_.
(The format of our PDB-style files is described here.)

Timeline for d2jeva_:

Domains from other chains:
(mouse over for more information)
d2jevb_