Lineage for d2jeka1 (2jek A:6-145)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780984Fold a.255: Rv1873-like [140735] (1 superfamily)
    multihelical; contains unusually short buried central helix
  4. 780985Superfamily a.255.1: Rv1873-like [140736] (1 family) (S)
  5. 780986Family a.255.1.1: Rv1873-like [140737] (1 protein)
    contains conserved motif HWuW at the beginning of the central helix
  6. 780987Protein Hypothetical protein Rv1873 (MT1922) [140738] (1 species)
  7. 780988Species Mycobacterium tuberculosis [TaxId:1773] [140739] (1 PDB entry)
    Uniprot O07756 6-145
  8. 780989Domain d2jeka1: 2jek A:6-145 [138286]
    complexed with gol, so4

Details for d2jeka1

PDB Entry: 2jek (more details), 1.38 Å

PDB Description: crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a
PDB Compounds: (A:) rv1873

SCOP Domain Sequences for d2jeka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeka1 a.255.1.1 (A:6-145) Hypothetical protein Rv1873 (MT1922) {Mycobacterium tuberculosis [TaxId: 1773]}
dpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleea
qaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfval
lakyygggedrrtvallavt

SCOP Domain Coordinates for d2jeka1:

Click to download the PDB-style file with coordinates for d2jeka1.
(The format of our PDB-style files is described here.)

Timeline for d2jeka1: