![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.255: Rv1873-like [140735] (1 superfamily) multihelical; contains unusually short buried central helix |
![]() | Superfamily a.255.1: Rv1873-like [140736] (1 family) ![]() |
![]() | Family a.255.1.1: Rv1873-like [140737] (1 protein) contains conserved motif HWuW at the beginning of the central helix |
![]() | Protein Hypothetical protein Rv1873 (MT1922) [140738] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [140739] (1 PDB entry) Uniprot O07756 6-145 |
![]() | Domain d2jeka1: 2jek A:6-145 [138286] complexed with gol, so4 |
PDB Entry: 2jek (more details), 1.38 Å
SCOP Domain Sequences for d2jeka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jeka1 a.255.1.1 (A:6-145) Hypothetical protein Rv1873 (MT1922) {Mycobacterium tuberculosis [TaxId: 1773]} dpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleea qaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfval lakyygggedrrtvallavt
Timeline for d2jeka1: