SCOP 1.73: Domain d2jeka1: 2jek A:6-145

Lineage for d2jeka1 (2jek A:6-145)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.255: Rv1873-like [140735] (1 superfamily)
   multihelical; contains unusually short buried central helix

4. Superfamily a.255.1: Rv1873-like [140736] (1 family)

5. Family a.255.1.1: Rv1873-like [140737] (1 protein)
   contains conserved motif HWuW at the beginning of the central helix

6. Protein Hypothetical protein Rv1873 (MT1922) [140738] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140739] (1 PDB entry)

8. Domain d2jeka1: 2jek A:6-145 [138286]
   complexed with gol, so4

Details for d2jeka1

PDB Entry: 2jek, 1.38 Å

PDB Description: crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a

PDB Compounds: (A:) rv1873

SCOP Domain Sequences for d2jeka1:

Sequence; same for both SEQRES and ATOM records:

>d2jeka1 a.255.1.1 (A:6-145) Hypothetical protein Rv1873 (MT1922) {Mycobacterium tuberculosis [TaxId: 1773]}
dpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleea
qaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfval
lakyygggedrrtvallavt

Timeline for d2jeka1:

• d2jeka1 is new in SCOP 1.73
  
• d2jeka1 appears in SCOP 1.75
  
• d2jeka1 appears in the current release, SCOPe 2.08