SCOPe 2.06: Domain d2jeia1: 2jei A:241-342

Lineage for d2jeia1 (2jei A:241-342)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (4 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)

8. Domain d2jeia1: 2jei A:241-342 [138282]
   Other proteins in same PDB: d2jeia2, d2jeia3
   automated match to d2v4ra2
   complexed with ca, dgt

Details for d2jeia1

PDB Entry: 2jei, 2.39 Å

PDB Description: the molecular basis of selectivity of nucleoside triphosphate incorporation opposite o6-benzylguanine by sulfolobus solfataricus dna polymerase iv: steady-state and pre-steady-state kinetics and x- ray crystallography of correct and incorrect pairing

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2jeia1:

Sequence; same for both SEQRES and ATOM records:

>d2jeia1 d.240.1.0 (A:241-342) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

Timeline for d2jeia1:

• d2jeia1 first appeared in SCOP 1.73
  
• d2jeia1 appears in SCOPe 2.05
  
• d2jeia1 appears in SCOPe 2.07
  
• d2jeia1 appears in the current release, SCOPe 2.08